UtilityAtlas

Long-tail words page

5 Letter Words

Explore 5-letter words for puzzles and word games. Need stricter filters? Use Word Finder with include/exclude letters, prefix, suffix, and pattern matching.

Quick Actions

Word List (2216)

abbeyabideaboutaboveabuseacornacresactedactoracuteadaptaddedadeptadmitadobeadoptadoreadultaffixafireafootafoulafteragainagentagileagingaglowagonyagreeaheadaidedaislealarmalbumalertalgaealiasalibialienalignalikealivealleyallotallowalloyaloftalonealongaloofaloudalphaaltaralteramassamazeamberambleamendamissamityamongampleamplyamuseangelangerangleangryangstanimeankleannexannoyannulanodeanticanvilaortaapartaphidapingapneaappleapplyapronaptlyarborardorarenaarguearisearmoraromaarosearrayarrowarsonartsyascotashenasideaskewassayassetatlasatollatoneatticaudioauditaugurauntyavailavertavianavoidawaitawakeawardawareawashawfulawokeaxialaxiomazurebaconbadgebadlybagelbaggybakerbalmybanalbanjobargebaronbasalbasicbasilbasinbasisbastebatchbathebatonbawdybeachbeadsbeardbeastbeechbeefybefitbeganbegetbeginbegunbeingbelchbeliebellebellybelowbenchberetberryberthbesetbevelbezelbiblebicepbigotbilgebingebingobiomebirchbirthbisonblackbladeblameblandblankblareblastblazebleakbleatbleedbleepblendblessblimpblindblinkblissblitzbloatblockblokeblondbloodbloomblownbluerbluffbluntblurbblurtblushboardboastboltsbonusboostboothbootyboozeboraxboredbornebosombossybotchboughboundbowelboxerbracebraidbrainbrakebrandbrashbrassbravebravobrawlbrawnbreadbreakbreedbriarbribebrickbridebriefbrinebringbrinkbrinybriskbroadbroilbrokebroodbrookbroombrothbrownbruntbrushbrutebuddybudgebuggybuglebuildbuiltbulgebulkybullybunchbunnyburlyburntburstbushybuttebuxombuyerbylawcabalcabincablecacaocachecacticaddycadetcageycairncamelcameocanalcandycannycanoecanoncapercaratcargocarolcarrycarvecastecatchcatercattycaulkcauseceasecedarcellochafechaffchainchairchalkchampchantchaoschardcharmchartchasechasmcheapcheatcheckcheekcheerchesschestchickchidechiefchildchilichillchimechinachirpchockchoirchokechompchordchorechosechuckchumpchunkchurnchutecidercigarcinchcircaciviccivilclaimclampclangclankclashclaspclasscleanclearcleatcleftclerkclickcliffclimbclingclinkcloakclockclonecloseclothcloudcloutcloveclowncluckclumpclungcoachcoastcobracocoacoloncolorcometcomfycomiccommaconchcondoconiccopsecoralcornycouchcoughcouldcountcoupecourtcovencovercovetcoveycowercrackcraftcrampcranecrankcrashcrasscratecravecrawlcrazecrazycreakcreamcredocreedcreekcreepcrepecreptcrestcriedcriercrimecrimpcrispcroakcrockcronecronycrookcrooncrowdcrowncrudecruelcrumbcrushcrustcryptcubiccumincuriocurlycursecurvecurvycutiecybercyclecynicdaddydailydairydaisydallydancedandydatumdauntdealtdeathdebitdebugdebutdecaldecaydecordecoydecrydeigndeitydelaydeltadelvedemondemurdenimdensedepotdepthderbydeterdetoxdevildiarydiceydigitdillydimlydinerdingodingydiodedirgedirtydiscoditchdittodittydiverdizzydodgedodgydogmadoingdollydonordonutdopeydoubtdoughdoweldownydowrydozendraftdraindrakedramadrankdrapedrawldrawndreaddreamdressdrieddrierdriftdrilldrinkdrivedrolldronedrooldroopdrossdrovedrowndruiddrunkdryerdrylyduchydullydummydumpydunceduskydustydwarfdwelldweltdyingeagereagleearlyeartheaseleateneaterebonyedictedifyeerieegreteightejectekingelateelbowelderelectelegyelfinelideeliteelopeeludeemailembedemberemceeemptyenactendowenemaenemyenjoyennuiensueenterentryenvoyepochepoxyequalequiperaseerecterodeerroreruptessayesteretherethicethosetudeevadeeventeveryevictevokeexactexaltexcelexertexileexistexpelextolextraexulteyingfablefacetfaintfairyfaithfalsefancyfarcefatalfattyfaultfaunafavorfeastfecalfeignfelonfemurfenceferalferryfetalfetchfetidfetusfeverfewerfiberficusfieldfiendfieryfifthfiftyfightfilerfiletfillyfilmyfilthfinalfinchfinerfirstfishyfixerfizzyfjordflailflairflakeflakyflameflankflareflashflaskfleckfleetfleshflickflierflingflintflirtfloatflockfloodfloorfloraflossflourfloutflownflufffluidflukeflumeflungflunkflushflutefoamyfocalfocusfoggyfoistfoliofollyforayforceforgeforgoforteforthfortyforumfoundfoyerfrailframefrankfraudfreakfreedfreerfreshfriarfriedfrillfriskfrockfrondfrontfrostfrothfrownfrozefruitfudgefuguefullyfungifunkyfunnyfurorfurryfussyfuzzygaffegailygamergammagamutgassygaugegauntgauzegavelgawkygazergeckogeekygeesegeniegenreghostghoulgiantgiddygirlygirthgivengivergladeglandglareglassglazegleamgleanglideglintgloatglobegloomgloryglossgloveglyphgnashgnomegodlygoinggolemgonadgonergooeygoofygoosegorgegougegourdgracegradegraftgraingrandgrantgrapegraphgraspgrassgrategravegravygrazegreatgreedgreengreetgriefgrillgrimegrimygrindgripegroangroingroomgropegrossgroupgroutgrovegrowlgrowngruelgruffgruntguardguavaguessguestguideguildguileguiltguisegulchgullygumbogummyguppygustogustygutsygypsyhabithairyhalvehandyhappyhardyharemharpyharshhastehastyhatchhaterhaunthavenhavochazelheadyheardheartheathheaveheavyhedgeheftyheisthelixhellohenceheronhillyhingehippohippyhitchhoardhobbyhoisthollyhomerhoneyhonorhordehornyhorsehotelhoundhousehovelhoverhowdyhumanhumidhumorhumushunchhunkyhurryhuskyhutchhydrohyenahypericilyicingidealidiomidiotidleridylliglooiliacimageimbueimpelimplyinaneinboxincurindexineptinertinferingotinlayinletinnerinputinterintroionicirateironyisletissueitchyitemsivoryjauntjazzyjellyjerkyjettyjeweljiffyjointjoistjokerjollyjoustjudgejuicejuicyjumbojumpyjuntajurorkappakarmakayakkebabkhakikinkykioskkittyknackknavekneadkneelkneltknifeknockknollknownkoalakrillkudoslabellaborladenladlelagerlancelankylapellapselargelarvalassolatchlaterlathelattelaughlayerleachleafyleakyleantleaptlearnleaseleashleastleaveledgeleechleeryleftylegalleggylemonlemurlevelleverlibelliegelightlikenlilaclimbolimitlinenlinerlingolipidliterlitheliverlividllamaloamyloathlobbylocallocuslodgeloftylogicloginloopylooselorryloserlouselousyloverlowerlowlyloyallucidluckylumenlumpylunarlunchlungelupuslurchluridlustylyinglymphlynchlyricmacawmachomacromadammadlymafiamagicmagmamaizemajormakermambomammamangomaniamanicmanlymanormaplemarchmarrymarshmasonmatchmateymauvemaximmaybemayormealymeantmeatymeccamedalmediamedicmeleemelonmercymergemeritmerrymessymetalmetedmetermetromicromidgemidstmightmilkymimicminceminerminormintyminusmirthmisermochamodalmodelmodemmogulmoistmolarmoldymoneymonthmoodymoosemoralmoronmorphmossymotelmotifmotormottomoundmountmournmousemouthmovermoviemowermucusmuddymulchmummymunchmuralmurkymushymusicmuskymustymyrrhnadirnaivenannynasalnastynatalnavalnavelneedyneighnerdynervenevernewernewlynicernicheniecenightninjaninnyninthnoblenoblynoisenoisynomadnoosenorthnoseynotchnotednovelnudgenursenuttynylonnymphoakenoasisobeseobeysoccuroceanoctaloctetodderoddlyoffalofferoftenoldenolderoliveombreomegaoniononsetoperaopineopiumopticorbitorderorganotherotteroughtounceoutdoouterovaryovateovertovineovoidowingowneroxideozonepaddypaganpaintpalerpalsypanelpanicpansypapalpaperparerparkaparryparsepartypastapastepastypatchpatiopatsypattypausepayeepayerpeacepeachpearlpecanpedalpenalpencepennepennyperchperilperkypeskypestopetalpettyphasephonephonyphotopianopickypiecepietypiggypilafpilotpinchpineypinkypintopiperpiquepitchpithypivotpixelpixiepizzaplaceplaidplainplaitplaneplankplantplateplazapleadpleatpliedplierpluckplumbplumeplumpplunkplushpointpoisepokerpolarpolkapolyppoochpoppyporchpositpossepouchpoundpoutypowerprankprawnpreenpresspriceprickpridepriedprimeprimoprintpriorprismprivyprizeprobeproneprongproofproseproudproveprowlproxyprudeprunepsalmpubicpudgypuffypulpypulsepunchpupilpuppypureepurerpurgepursepushyputtypygmyqualmquarkquartquasiqueenqueerquellqueryquestqueuequickquietquillquiltquirkquitequotaquotequothrabbirabidracerradarradiiradiorainyraiserajahrallyramenranchrandyrangerapidratiorattyravenrayonrazorreachreactreadyrealmrearmrebarrebelrebusrebutrecaprecurrecutreedyreferrefitregalrehabreignrelaxrelayrelicremitrenalrenewrepayrepelreplyrerunresetresinretchretroretryreuserevelrevuerhinorhymeriderridgeriflerightrigidrigorrinseripenriperrisenriserriskyrivalriverrivetroastrobinrobotrockyrodeorogueroomyroostrotorrougeroughroundrouserouteroverrowdyrowerroyalruddyruderrugbyrulerrumbarumorrupeeruralrustysadlysafersaintsaladsallysalonsalsasaltysalvesalvosandysanersappysassysatinsatyrsaucesaucysaunasautesavorsavvyscaldscalescalpscalyscampscantscarescarfscaryscenescentscionscoffscoldsconescoopscopescorescornscourscoutscowlscramscrapscreescrewscrubscrumscubasedanseedysegueseizesemensensesepiaserifserumservesetupsevenseversewershackshadeshadyshaftshakeshakyshaleshallshaltshameshankshapeshardsharesharksharpshaveshawlshearsheensheepsheersheetshelfshellshiedshiftshineshinyshireshirkshirtshoalshockshoneshookshootshoreshornshortshoutshoveshownshowyshrewshrubshrugshuckshuntshushshylysiegesievesightsigmasilkysillysincesinewsingesirensissysixthsixtyskateskierskiffskillskimpskirtskulkskullskunkslackslainslangslantslashslateslavesleeksleepsleetsleptsliceslickslideslimeslimyslingslinkslopesloshslothslumpslungslunkslurpslushslylysmacksmallsmartsmashsmearsmellsmeltsmilesmirksmitesmithsmocksmokesmokysmotesnacksnailsnakesnakysnaresnarlsneaksneersnidesniffsnipesnoopsnoresnortsnoutsnowysnucksnuffsoapysobersoggysolarsolidsolvesonarsonicsootysorrysoundsouthspacespadespanksparesparkspasmspawnspeakspearspeckspeedspellspendspentspermspicespicyspiedspielspikespikyspillspiltspinespinyspirespitesplatsplitspoilspokespoofspookspoolspoonsporesportspoutsprayspreesprigspurnspurtsquadsquatsquibstackstaffstagestaidstainstairstakestalestalkstallstampstandstankstarestarkstartstashstatestavesteadsteakstealsteamsteedsteelsteepsteersteinsternstickstiffstillstiltstingstinkstintstockstoicstokestolestompstonestonystoodstoolstoopstorestorkstormstorystoutstovestrapstrawstraystripstrutstuckstudystuffstumpstungstunkstuntstylesuavesugarsuingsuitesulkysullysumacsunnysupersurersurgesurlysushiswamiswampswarmswathswearsweatsweepsweetswellsweptswiftswillswineswingswirlswishswoonswoopswordsworeswornswungsynodsyruptabbytabletabootacittackytaffytainttakentakertallytalontamertangotangytapertapirtardytarottastetastytattytaunttawnyteachtearyteaseteddyteethtempotenettenortensetenthtepidtersetestythankthefttheirthemetherethesethetathickthiefthighthingthinkthirdthongthornthosethreethrewthrobthrowthrumthumbthumpthymetiaratibiatidaltigertighttildetimertimidtitantithetitletoasttodaytoddytokentonaltonictoothtopaztopictorchtorsotorustotaltotemtouchtoughtoweltowertoxictoxintracetracktracttradetrailtraintraittramptrashtrawltreadtreattrendtriadtrialtribetricetricktriedtripetritetrolltrooptropetrouttrovetrucetrucktruertrulytrumptrunktrusstrusttruthtrysttubaltubertuliptulletumortunicturbotutortwangtweaktweedtweettwicetwinetwirltwisttyingudderulcerultraumbrauncleuncutunderundidundueunfedunfitunifyunionuniteunityunlitunmetunsetuntieuntilunwedunzipupperupseturbanurineusageusherusingusualusurputileuttervaguevaletvalidvalorvaluevalvevapidvaporvaultvauntveganvenomvenuevergeverseversovervevicarvideovigilvigorvillavinylviolaviperviralvirusvisitvisorvistavitalvividvixenvocalvodkavoguevoicevomitvotervouchvowelvyingwackywaferwagerwagonwaistwaivewaltzwartywastewatchwaterwaverwaxenwearyweavewedgeweedyweighweirdwelshwhackwhalewharfwheatwheelwhelpwherewhichwhiffwhilewhinewhinywhirlwhiskwhitewholewhoopwhosewidenwiderwidowwidthwieldwincewinchwindywiserwispywitchwittywokenwomanwomenwoodywoolywoozywordyworldworryworseworstworthwouldwoundwovenwrackwrathwreakwreckwrestwringwristwritewrongwrotewrungwrylyxenonxeroxyachtyearnyeastyieldyoungyouthyummyzebrazestyzonal

Grouped by starting letter

a

abbey, abide, about, above, abuse, acorn, acres, acted, actor, acute, adapt, added, adept, admit, adobe, adopt, adore, adult, affix, afire, afoot, afoul, after, again, agent, agile, aging, aglow, agony, agree, ahead, aided, aisle, alarm, album, alert, algae, alias, alibi, alien, align, alike, alive, alley, allot, allow, alloy, aloft, alone, along, aloof, aloud, alpha, altar, alter, amass, amaze, amber, amble, amend, amiss, amity, among, ample, amply, amuse, angel, anger, angle, angry, angst, anime, ankle, annex, annoy, annul, anode, antic, anvil, aorta, apart, aphid, aping, apnea, apple, apply, apron, aptly, arbor, ardor, arena, argue, arise, armor, aroma, arose, array, arrow, arson, artsy, ascot, ashen, aside, askew, assay, asset, atlas, atoll, atone, attic, audio, audit, augur, aunty, avail, avert, avian, avoid, await, awake, award, aware, awash, awful, awoke, axial, axiom, azure

b

bacon, badge, badly, bagel, baggy, baker, balmy, banal, banjo, barge, baron, basal, basic, basil, basin, basis, baste, batch, bathe, baton, bawdy, beach, beads, beard, beast, beech, beefy, befit, began, beget, begin, begun, being, belch, belie, belle, belly, below, bench, beret, berry, berth, beset, bevel, bezel, bible, bicep, bigot, bilge, binge, bingo, biome, birch, birth, bison, black, blade, blame, bland, blank, blare, blast, blaze, bleak, bleat, bleed, bleep, blend, bless, blimp, blind, blink, bliss, blitz, bloat, block, bloke, blond, blood, bloom, blown, bluer, bluff, blunt, blurb, blurt, blush, board, boast, bolts, bonus, boost, booth, booty, booze, borax, bored, borne, bosom, bossy, botch, bough, bound, bowel, boxer, brace, braid, brain, brake, brand, brash, brass, brave, bravo, brawl, brawn, bread, break, breed, briar, bribe, brick, bride, brief, brine, bring, brink, briny, brisk, broad, broil, broke, brood, brook, broom, broth, brown, brunt, brush, brute, buddy, budge, buggy, bugle, build, built, bulge, bulky, bully, bunch, bunny, burly, burnt, burst, bushy, butte, buxom, buyer, bylaw

c

cabal, cabin, cable, cacao, cache, cacti, caddy, cadet, cagey, cairn, camel, cameo, canal, candy, canny, canoe, canon, caper, carat, cargo, carol, carry, carve, caste, catch, cater, catty, caulk, cause, cease, cedar, cello, chafe, chaff, chain, chair, chalk, champ, chant, chaos, chard, charm, chart, chase, chasm, cheap, cheat, check, cheek, cheer, chess, chest, chick, chide, chief, child, chili, chill, chime, china, chirp, chock, choir, choke, chomp, chord, chore, chose, chuck, chump, chunk, churn, chute, cider, cigar, cinch, circa, civic, civil, claim, clamp, clang, clank, clash, clasp, class, clean, clear, cleat, cleft, clerk, click, cliff, climb, cling, clink, cloak, clock, clone, close, cloth, cloud, clout, clove, clown, cluck, clump, clung, coach, coast, cobra, cocoa, colon, color, comet, comfy, comic, comma, conch, condo, conic, copse, coral, corny, couch, cough, could, count, coupe, court, coven, cover, covet, covey, cower, crack, craft, cramp, crane, crank, crash, crass, crate, crave, crawl, craze, crazy, creak, cream, credo, creed, creek, creep, crepe, crept, crest, cried, crier, crime, crimp, crisp, croak, crock, crone, crony, crook, croon, crowd, crown, crude, cruel, crumb, crush, crust, crypt, cubic, cumin, curio, curly, curse, curve, curvy, cutie, cyber, cycle, cynic

d

daddy, daily, dairy, daisy, dally, dance, dandy, datum, daunt, dealt, death, debit, debug, debut, decal, decay, decor, decoy, decry, deign, deity, delay, delta, delve, demon, demur, denim, dense, depot, depth, derby, deter, detox, devil, diary, dicey, digit, dilly, dimly, diner, dingo, dingy, diode, dirge, dirty, disco, ditch, ditto, ditty, diver, dizzy, dodge, dodgy, dogma, doing, dolly, donor, donut, dopey, doubt, dough, dowel, downy, dowry, dozen, draft, drain, drake, drama, drank, drape, drawl, drawn, dread, dream, dress, dried, drier, drift, drill, drink, drive, droll, drone, drool, droop, dross, drove, drown, druid, drunk, dryer, dryly, duchy, dully, dummy, dumpy, dunce, dusky, dusty, dwarf, dwell, dwelt, dying

e

eager, eagle, early, earth, easel, eaten, eater, ebony, edict, edify, eerie, egret, eight, eject, eking, elate, elbow, elder, elect, elegy, elfin, elide, elite, elope, elude, email, embed, ember, emcee, empty, enact, endow, enema, enemy, enjoy, ennui, ensue, enter, entry, envoy, epoch, epoxy, equal, equip, erase, erect, erode, error, erupt, essay, ester, ether, ethic, ethos, etude, evade, event, every, evict, evoke, exact, exalt, excel, exert, exile, exist, expel, extol, extra, exult, eying

f

fable, facet, faint, fairy, faith, false, fancy, farce, fatal, fatty, fault, fauna, favor, feast, fecal, feign, felon, femur, fence, feral, ferry, fetal, fetch, fetid, fetus, fever, fewer, fiber, ficus, field, fiend, fiery, fifth, fifty, fight, filer, filet, filly, filmy, filth, final, finch, finer, first, fishy, fixer, fizzy, fjord, flail, flair, flake, flaky, flame, flank, flare, flash, flask, fleck, fleet, flesh, flick, flier, fling, flint, flirt, float, flock, flood, floor, flora, floss, flour, flout, flown, fluff, fluid, fluke, flume, flung, flunk, flush, flute, foamy, focal, focus, foggy, foist, folio, folly, foray, force, forge, forgo, forte, forth, forty, forum, found, foyer, frail, frame, frank, fraud, freak, freed, freer, fresh, friar, fried, frill, frisk, frock, frond, front, frost, froth, frown, froze, fruit, fudge, fugue, fully, fungi, funky, funny, furor, furry, fussy, fuzzy

g

gaffe, gaily, gamer, gamma, gamut, gassy, gauge, gaunt, gauze, gavel, gawky, gazer, gecko, geeky, geese, genie, genre, ghost, ghoul, giant, giddy, girly, girth, given, giver, glade, gland, glare, glass, glaze, gleam, glean, glide, glint, gloat, globe, gloom, glory, gloss, glove, glyph, gnash, gnome, godly, going, golem, gonad, goner, gooey, goofy, goose, gorge, gouge, gourd, grace, grade, graft, grain, grand, grant, grape, graph, grasp, grass, grate, grave, gravy, graze, great, greed, green, greet, grief, grill, grime, grimy, grind, gripe, groan, groin, groom, grope, gross, group, grout, grove, growl, grown, gruel, gruff, grunt, guard, guava, guess, guest, guide, guild, guile, guilt, guise, gulch, gully, gumbo, gummy, guppy, gusto, gusty, gutsy, gypsy

h

habit, hairy, halve, handy, happy, hardy, harem, harpy, harsh, haste, hasty, hatch, hater, haunt, haven, havoc, hazel, heady, heard, heart, heath, heave, heavy, hedge, hefty, heist, helix, hello, hence, heron, hilly, hinge, hippo, hippy, hitch, hoard, hobby, hoist, holly, homer, honey, honor, horde, horny, horse, hotel, hound, house, hovel, hover, howdy, human, humid, humor, humus, hunch, hunky, hurry, husky, hutch, hydro, hyena, hyper

i

icily, icing, ideal, idiom, idiot, idler, idyll, igloo, iliac, image, imbue, impel, imply, inane, inbox, incur, index, inept, inert, infer, ingot, inlay, inlet, inner, input, inter, intro, ionic, irate, irony, islet, issue, itchy, items, ivory

j

jaunt, jazzy, jelly, jerky, jetty, jewel, jiffy, joint, joist, joker, jolly, joust, judge, juice, juicy, jumbo, jumpy, junta, juror

k

kappa, karma, kayak, kebab, khaki, kinky, kiosk, kitty, knack, knave, knead, kneel, knelt, knife, knock, knoll, known, koala, krill, kudos

l

label, labor, laden, ladle, lager, lance, lanky, lapel, lapse, large, larva, lasso, latch, later, lathe, latte, laugh, layer, leach, leafy, leaky, leant, leapt, learn, lease, leash, least, leave, ledge, leech, leery, lefty, legal, leggy, lemon, lemur, level, lever, libel, liege, light, liken, lilac, limbo, limit, linen, liner, lingo, lipid, liter, lithe, liver, livid, llama, loamy, loath, lobby, local, locus, lodge, lofty, logic, login, loopy, loose, lorry, loser, louse, lousy, lover, lower, lowly, loyal, lucid, lucky, lumen, lumpy, lunar, lunch, lunge, lupus, lurch, lurid, lusty, lying, lymph, lynch, lyric

m

macaw, macho, macro, madam, madly, mafia, magic, magma, maize, major, maker, mambo, mamma, mango, mania, manic, manly, manor, maple, march, marry, marsh, mason, match, matey, mauve, maxim, maybe, mayor, mealy, meant, meaty, mecca, medal, media, medic, melee, melon, mercy, merge, merit, merry, messy, metal, meted, meter, metro, micro, midge, midst, might, milky, mimic, mince, miner, minor, minty, minus, mirth, miser, mocha, modal, model, modem, mogul, moist, molar, moldy, money, month, moody, moose, moral, moron, morph, mossy, motel, motif, motor, motto, mound, mount, mourn, mouse, mouth, mover, movie, mower, mucus, muddy, mulch, mummy, munch, mural, murky, mushy, music, musky, musty, myrrh

n

nadir, naive, nanny, nasal, nasty, natal, naval, navel, needy, neigh, nerdy, nerve, never, newer, newly, nicer, niche, niece, night, ninja, ninny, ninth, noble, nobly, noise, noisy, nomad, noose, north, nosey, notch, noted, novel, nudge, nurse, nutty, nylon, nymph

o

oaken, oasis, obese, obeys, occur, ocean, octal, octet, odder, oddly, offal, offer, often, olden, older, olive, ombre, omega, onion, onset, opera, opine, opium, optic, orbit, order, organ, other, otter, ought, ounce, outdo, outer, ovary, ovate, overt, ovine, ovoid, owing, owner, oxide, ozone

p

paddy, pagan, paint, paler, palsy, panel, panic, pansy, papal, paper, parer, parka, parry, parse, party, pasta, paste, pasty, patch, patio, patsy, patty, pause, payee, payer, peace, peach, pearl, pecan, pedal, penal, pence, penne, penny, perch, peril, perky, pesky, pesto, petal, petty, phase, phone, phony, photo, piano, picky, piece, piety, piggy, pilaf, pilot, pinch, piney, pinky, pinto, piper, pique, pitch, pithy, pivot, pixel, pixie, pizza, place, plaid, plain, plait, plane, plank, plant, plate, plaza, plead, pleat, plied, plier, pluck, plumb, plume, plump, plunk, plush, point, poise, poker, polar, polka, polyp, pooch, poppy, porch, posit, posse, pouch, pound, pouty, power, prank, prawn, preen, press, price, prick, pride, pried, prime, primo, print, prior, prism, privy, prize, probe, prone, prong, proof, prose, proud, prove, prowl, proxy, prude, prune, psalm, pubic, pudgy, puffy, pulpy, pulse, punch, pupil, puppy, puree, purer, purge, purse, pushy, putty, pygmy

q

qualm, quark, quart, quasi, queen, queer, quell, query, quest, queue, quick, quiet, quill, quilt, quirk, quite, quota, quote, quoth

r

rabbi, rabid, racer, radar, radii, radio, rainy, raise, rajah, rally, ramen, ranch, randy, range, rapid, ratio, ratty, raven, rayon, razor, reach, react, ready, realm, rearm, rebar, rebel, rebus, rebut, recap, recur, recut, reedy, refer, refit, regal, rehab, reign, relax, relay, relic, remit, renal, renew, repay, repel, reply, rerun, reset, resin, retch, retro, retry, reuse, revel, revue, rhino, rhyme, rider, ridge, rifle, right, rigid, rigor, rinse, ripen, riper, risen, riser, risky, rival, river, rivet, roast, robin, robot, rocky, rodeo, rogue, roomy, roost, rotor, rouge, rough, round, rouse, route, rover, rowdy, rower, royal, ruddy, ruder, rugby, ruler, rumba, rumor, rupee, rural, rusty

s

sadly, safer, saint, salad, sally, salon, salsa, salty, salve, salvo, sandy, saner, sappy, sassy, satin, satyr, sauce, saucy, sauna, saute, savor, savvy, scald, scale, scalp, scaly, scamp, scant, scare, scarf, scary, scene, scent, scion, scoff, scold, scone, scoop, scope, score, scorn, scour, scout, scowl, scram, scrap, scree, screw, scrub, scrum, scuba, sedan, seedy, segue, seize, semen, sense, sepia, serif, serum, serve, setup, seven, sever, sewer, shack, shade, shady, shaft, shake, shaky, shale, shall, shalt, shame, shank, shape, shard, share, shark, sharp, shave, shawl, shear, sheen, sheep, sheer, sheet, shelf, shell, shied, shift, shine, shiny, shire, shirk, shirt, shoal, shock, shone, shook, shoot, shore, shorn, short, shout, shove, shown, showy, shrew, shrub, shrug, shuck, shunt, shush, shyly, siege, sieve, sight, sigma, silky, silly, since, sinew, singe, siren, sissy, sixth, sixty, skate, skier, skiff, skill, skimp, skirt, skulk, skull, skunk, slack, slain, slang, slant, slash, slate, slave, sleek, sleep, sleet, slept, slice, slick, slide, slime, slimy, sling, slink, slope, slosh, sloth, slump, slung, slunk, slurp, slush, slyly, smack, small, smart, smash, smear, smell, smelt, smile, smirk, smite, smith, smock, smoke, smoky, smote, snack, snail, snake, snaky, snare, snarl, sneak, sneer, snide, sniff, snipe, snoop, snore, snort, snout, snowy, snuck, snuff, soapy, sober, soggy, solar, solid, solve, sonar, sonic, sooty, sorry, sound, south, space, spade, spank, spare, spark, spasm, spawn, speak, spear, speck, speed, spell, spend, spent, sperm, spice, spicy, spied, spiel, spike, spiky, spill, spilt, spine, spiny, spire, spite, splat, split, spoil, spoke, spoof, spook, spool, spoon, spore, sport, spout, spray, spree, sprig, spurn, spurt, squad, squat, squib, stack, staff, stage, staid, stain, stair, stake, stale, stalk, stall, stamp, stand, stank, stare, stark, start, stash, state, stave, stead, steak, steal, steam, steed, steel, steep, steer, stein, stern, stick, stiff, still, stilt, sting, stink, stint, stock, stoic, stoke, stole, stomp, stone, stony, stood, stool, stoop, store, stork, storm, story, stout, stove, strap, straw, stray, strip, strut, stuck, study, stuff, stump, stung, stunk, stunt, style, suave, sugar, suing, suite, sulky, sully, sumac, sunny, super, surer, surge, surly, sushi, swami, swamp, swarm, swath, swear, sweat, sweep, sweet, swell, swept, swift, swill, swine, swing, swirl, swish, swoon, swoop, sword, swore, sworn, swung, synod, syrup

t

tabby, table, taboo, tacit, tacky, taffy, taint, taken, taker, tally, talon, tamer, tango, tangy, taper, tapir, tardy, tarot, taste, tasty, tatty, taunt, tawny, teach, teary, tease, teddy, teeth, tempo, tenet, tenor, tense, tenth, tepid, terse, testy, thank, theft, their, theme, there, these, theta, thick, thief, thigh, thing, think, third, thong, thorn, those, three, threw, throb, throw, thrum, thumb, thump, thyme, tiara, tibia, tidal, tiger, tight, tilde, timer, timid, titan, tithe, title, toast, today, toddy, token, tonal, tonic, tooth, topaz, topic, torch, torso, torus, total, totem, touch, tough, towel, tower, toxic, toxin, trace, track, tract, trade, trail, train, trait, tramp, trash, trawl, tread, treat, trend, triad, trial, tribe, trice, trick, tried, tripe, trite, troll, troop, trope, trout, trove, truce, truck, truer, truly, trump, trunk, truss, trust, truth, tryst, tubal, tuber, tulip, tulle, tumor, tunic, turbo, tutor, twang, tweak, tweed, tweet, twice, twine, twirl, twist, tying

u

udder, ulcer, ultra, umbra, uncle, uncut, under, undid, undue, unfed, unfit, unify, union, unite, unity, unlit, unmet, unset, untie, until, unwed, unzip, upper, upset, urban, urine, usage, usher, using, usual, usurp, utile, utter

v

vague, valet, valid, valor, value, valve, vapid, vapor, vault, vaunt, vegan, venom, venue, verge, verse, verso, verve, vicar, video, vigil, vigor, villa, vinyl, viola, viper, viral, virus, visit, visor, vista, vital, vivid, vixen, vocal, vodka, vogue, voice, vomit, voter, vouch, vowel, vying

w

wacky, wafer, wager, wagon, waist, waive, waltz, warty, waste, watch, water, waver, waxen, weary, weave, wedge, weedy, weigh, weird, welsh, whack, whale, wharf, wheat, wheel, whelp, where, which, whiff, while, whine, whiny, whirl, whisk, white, whole, whoop, whose, widen, wider, widow, width, wield, wince, winch, windy, wiser, wispy, witch, witty, woken, woman, women, woody, wooly, woozy, wordy, world, worry, worse, worst, worth, would, wound, woven, wrack, wrath, wreak, wreck, wrest, wring, wrist, write, wrong, wrote, wrung, wryly

x

xenon, xerox

y

yacht, yearn, yeast, yield, young, youth, yummy

z

zebra, zesty, zonal